SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|52426787|ref|NP_002535.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|52426787|ref|NP_002535.3|
Domain Number 1 Region: 30-260
Classification Level Classification E-value
Superfamily L domain-like 8.26e-41
Family Ngr ectodomain-like 0.0051
Further Details:      
 
Weak hits

Sequence:  gi|52426787|ref|NP_002535.3|
Domain Number - Region: 316-393
Classification Level Classification E-value
Superfamily FAS1 domain 0.0019
Family FAS1 domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|52426787|ref|NP_002535.3|
Sequence length 440
Comment oligodendrocyte-myelin glycoprotein precursor [Homo sapiens]
Sequence
MEYQILKMSLCLFILLFLTPGILCICPLQCICTERHRHVDCSGRNLSTLPSGLQENIIHL
NLSYNHFTDLHNQLTQYTNLRTLDISNNRLESLPAHLPRSLWNMSAANNNIKLLDKSDTA
YQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLT
QILPGTLINLTNLTHLYLHNNKFTFIPDQSFDQLFQLQEITLYNNRWSCDHKQNITYLLK
WMMETKAHVIGTPCSTQISSLKEHNMYPTPSGFTSSLFTVSGMQTVDTINSLSVVTQPKV
TKIPKQYRTKETTFGATLSKDTTFTSTDKAFVPYPEDTSTETINSHEAAAATLTIHLQDG
MVTNTSLTSSTKSSPTPMTLSITSGMPNNFSEMPQQSTTLNLWREETTTNVKTPLPSVAN
AWKVNASFLLLLNVVVMLAV
Download sequence
Identical sequences P23515
9606.ENSP00000247271 NP_002535.3.87134 NP_002535.3.92137 ENSP00000247271 ENSP00000247271 gi|52426787|ref|NP_002535.3| ENSP00000247271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]