SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|53729361|ref|NP_001005373.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|53729361|ref|NP_001005373.1|
Domain Number 1 Region: 34-185
Classification Level Classification E-value
Superfamily L domain-like 1.36e-30
Family Ngr ectodomain-like 0.039
Further Details:      
 
Domain Number 2 Region: 571-631
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000114
Family SAM (sterile alpha motif) domain 0.0059
Further Details:      
 
Domain Number 3 Region: 667-716
Classification Level Classification E-value
Superfamily RING/U-box 0.00000275
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Weak hits

Sequence:  gi|53729361|ref|NP_001005373.1|
Domain Number - Region: 295-355
Classification Level Classification E-value
Superfamily Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain 0.00994
Family Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|53729361|ref|NP_001005373.1|
Sequence length 723
Comment E3 ubiquitin-protein ligase LRSAM1 isoform 1 [Homo sapiens]
Sequence
MPLFFRKRKPSEEARKRLEYQMCLAKEAGADDILDISKCELSEIPFGAFATCKVLQKKVL
IVHTNHLTSLLPKSCSLLSLATIKVLDLHDNQLTALPDDLGQLTALQVLNVERNQLMQLP
RSIGNLTQLQTLNVKDNKLKELPDTVGELRSLRTLNISGNEIQRLPQMLAHVRTLEMLSL
DASAMVYPPREVCGAGTAAILQFLCKESGLEYYPPSQYLLPILEQDGIENSRDSPDGPTD
RFSREELEWQNRFSDYEKRKEQKMLEKLEFERRLELGQREHTQLLQQSSSQKDEILQTVK
EEQSRLEQGLSEHQRHLNAERQRLQEQLKQTEQNISSRIQKLLQDNQRQKKSSEILKSLE
NERIRMEQLMSITQEETESLRRRDVASAMQQMLTESCKNRLIQMAYESQRQNLVQQACSS
MAEMDERFQQILSWQQMDQNKAISQILQESAMQKAAFEALQVKKDLMHRQIRSQIKLIET
ELLQLTQLELKRKSLDTESLQEMISEQRWALSSLLQQLLKEKQQREEELREILTELEAKS
ETRQENYWLIQYQRLLNQKPLSLKLQEEGMERQLVALLEELSAEHYLPIFAHHRLSLDLL
SQMSPGDLAKVGVSEAGLQHEILRRVQELLDAARIQPELKPPMGEVVTPTAPQEPPESVR
PSAPPAELEVQASECVVCLEREAQMIFLNCGHVCCCQQCCQPLRTCPLCRQDIAQRLRIY
HSS
Download sequence
Identical sequences A0A024R870 Q6UWE0
gi|53729359|ref|NP_612370.3| gi|53729361|ref|NP_001005373.1| gi|53729363|ref|NP_001005374.1| ENSP00000300417 ENSP00000322937 ENSP00000362419 ENSP00000322937 ENSP00000300417 ENSP00000322937 ENSP00000362419 NP_001005373.1.87134 NP_001005373.1.92137 NP_001005374.1.87134 NP_001005374.1.92137 NP_612370.3.87134 NP_612370.3.92137 XP_016870772.1.92137 9606.ENSP00000300417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]