SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|53828918|ref|NP_004572.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|53828918|ref|NP_004572.3|
Domain Number 1 Region: 1-242,351-441
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 7.32e-93
Family Protein prenylyltransferase 0.0000000000131
Further Details:      
 
Domain Number 2 Region: 241-349
Classification Level Classification E-value
Superfamily Rab geranylgeranyltransferase alpha-subunit, insert domain 2.48e-50
Family Rab geranylgeranyltransferase alpha-subunit, insert domain 0.0000022
Further Details:      
 
Domain Number 3 Region: 446-562
Classification Level Classification E-value
Superfamily L domain-like 1.19e-21
Family Rab geranylgeranyltransferase alpha-subunit, C-terminal domain 0.00000485
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|53828918|ref|NP_004572.3|
Sequence length 567
Comment geranylgeranyl transferase type-2 subunit alpha [Homo sapiens]
Sequence
MHGRLKVKTSEEQAEAKRLEREQKLKLYQSATQAVFQKRQAGELDESVLELTSQILGANP
DFATLWNCRREVLQQLETQKSPEELAALVKAELGFLESCLRVNPKSYGTWHHRCWLLGRL
PEPNWTRELELCARFLEVDERNFHCWDYRRFVATQAAVPPAEELAFTDSLITRNFSNYSS
WHYRSCLLPQLHPQPDSGPQGRLPEDVLLKELELVQNAFFTDPNDQSAWFYHRWLLGRAD
PQDALRCLHVSRDEACLTVSFSRPLLVGSRMEILLLMVDDSPLIVEWRTPDGRNRPSHVW
LCDLPAASLNDQLPQHTFRVIWTAGDVQKECVLLKGRQEGWCRDSTTDEQLFRCELSVEK
STVLQSELESCKELQELEPENKWCLLTIILLMRALDPLLYEKETLQYFQTLKAVDPMRAT
YLDDLRSKFLLENSVLKMEYAEVRVLHLAHKDLTVLCHLEQLLLVTHLDLSHNRLRTLPP
ALAALRCLEVLQASDNAIESLDGVTNLPRLQELLLCNNRLQQPAVLQPLASCPRLVLLNL
QGNPLCQAVGILEQLAELLPSVSSVLT
Download sequence
Identical sequences Q92696
NP_004572.3.87134 NP_004572.3.92137 NP_878256.1.87134 NP_878256.1.92137 ENSP00000216840 ENSP00000216840 ENSP00000382341 9606.ENSP00000216840 ENSP00000216840 ENSP00000382341 gi|33469951|ref|NP_878256.1| gi|53828918|ref|NP_004572.3|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]