SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|53832014|ref|NP_001812.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|53832014|ref|NP_001812.2|
Domain Number 1 Region: 4-450,562-617
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.12e-75
Family GDI-like N domain 0.0000000000218
Further Details:      
 
Domain Number 2 Region: 451-561
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.41e-38
Family GDI-like 0.00000346
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|53832014|ref|NP_001812.2|
Sequence length 656
Comment rab proteins geranylgeranyltransferase component A 2 [Homo sapiens]
Sequence
MADNLPTEFDVVIIGTGLPESILAAACSRSGQRVLHIDSRSYYGGNWASFSFSGLLSWLK
EYQQNNDIGEESTVVWQDLIHETEEAITLRKKDETIQHTEAFCYASQDMEDNVEEIGALQ
KNPSLGVSNTFTEVLDSALPEESQLSYFNSDEMPAKHTQKSDTEISLEVTDVEESVEKEK
YCGDKTCMHTVSDKDGDKDESKSTVEDKADEPIRNRITYSQIVKEGRRFNIDLVSKLLYS
QGLLIDLLIKSDVSRYVEFKNVTRILAFREGKVEQVPCSRADVFNSKELTMVEKRMLMKF
LTFCLEYEQHPDEYQAFRQCSFSEYLKTKKLTPNLQHFVLHSIAMTSESSCTTIDGLNAT
KNFLQCLGRFGNTPFLFPLYGQGEIPQGFCRMCAVFGGIYCLRHKVQCFVVDKESGRCKA
IIDHFGQRINAKYFIVEDSYLSEETCSNVQYKQISRAVLITDQSILKTDLDQQTSILIVP
PAEPGACAVRVTELCSSTMTCMKDTYLVHLTCSSSKTAREDLESVVKKLFTPYTETEINE
EELTKPRLLWALYFNMRDSSGISRSSYNGLPSNVYVCSGPDCGLGNEHAVKQAETLFQEI
FPTEEFCPPPPNPEDIIFDGDDKQPEAPGTNNVVMAKLESSEESKNLESPEKHLQN
Download sequence
Identical sequences P26374
ENSP00000355511 gi|53832014|ref|NP_001812.2| NP_001812.2.87134 NP_001812.2.92137 ENSP00000355511 9606.ENSP00000355511 ENSP00000355511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]