SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|54112420|ref|NP_733762.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|54112420|ref|NP_733762.2|
Domain Number 1 Region: 41-169
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 8.24e-57
Family N-terminal domain of cbl (N-cbl) 0.00000141
Further Details:      
 
Domain Number 2 Region: 256-342
Classification Level Classification E-value
Superfamily SH2 domain 2.8e-47
Family SH2 domain 0.00000425
Further Details:      
 
Domain Number 3 Region: 349-426
Classification Level Classification E-value
Superfamily RING/U-box 1.04e-42
Family RING finger domain, C3HC4 0.0000109
Further Details:      
 
Domain Number 4 Region: 171-255
Classification Level Classification E-value
Superfamily EF-hand 6.8e-37
Family EF-hand modules in multidomain proteins 0.0000106
Further Details:      
 
Weak hits

Sequence:  gi|54112420|ref|NP_733762.2|
Domain Number - Region: 926-969
Classification Level Classification E-value
Superfamily UBA-like 0.000148
Family UBA domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|54112420|ref|NP_733762.2|
Sequence length 982
Comment E3 ubiquitin-protein ligase CBL-B [Homo sapiens]
Sequence
MANSMNGRNPGGRGGNPRKGRILGIIDAIQDAVGPPKQAAADRRTVEKTWKLMDKVVRLC
QNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKR
AIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAAE
FWRKFFGDKTIVPWKVFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLF
QPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYV
TGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQY
ELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEP
IIVDPFDPRDEGSRCCSIIDPFGMPMLDLDDDDDREESLMMNRLANVRKCTDRQNSPVTS
PGSSPLAQRRKPQPDPLQIPHLSLPPVPPRLDLIQKGIVRSPCGSPTGSPKSSPCMVRKQ
DKPLPAPPPPLRDPPPPPPERPPPIPPDNRLSRHIHHVESVPSRDPPMPLEAWCPRDVFG
TNQLVGCRLLGEGSPKPGITASSNVNGRHSRVGSDPVLMRKHRRHDLPLEGAKVFSNGHL
GSEEYDVPPRLSPPPPVTTLLPSIKCTGPLANSLSEKTRDPVEEDDDEYKIPSSHPVSLN
SQPSHCHNVKPPVRSCDNGHCMLNGTHGPSSEKKSNIPDLSIYLKGDVFDSASDPVPLPP
ARPPTRDNPKHGSSLNRTPSDYDLLIPPLGEDAFDALPPSLPPPPPPARHSLIEHSKPPG
SSSRPSSGQDLFLLPSDPFVDLASGQVPLPPARRLPGENVKTNRTSQDYDQLPSCSDGSQ
APARPPKPRPRRTAPEIHHRKPHGPEAALENVDAKIAKLMGEGYAFEEVKRALEIAQNNV
EVARSILREFAFPPPVSPRLNL
Download sequence
Identical sequences Q13191
NP_001308717.1.87134 NP_001308717.1.92137 NP_733762.2.87134 NP_733762.2.92137 XP_011511559.1.92137 ENSP00000264122 ENSP00000264122 HR4807 ENSP00000264122 gi|54112420|ref|NP_733762.2| 9606.ENSP00000264122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]