SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|5453541|ref|NP_006399.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|5453541|ref|NP_006399.1|
Domain Number 1 Region: 49-146
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000426
Family Thioltransferase 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|5453541|ref|NP_006399.1|
Sequence length 175
Comment anterior gradient protein 2 homolog precursor [Homo sapiens]
Sequence
MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEE
ALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSP
DGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL
Download sequence
Identical sequences O95994 Q4JM46
gi|5453541|ref|NP_006399.1| NP_006399.1.87134 NP_006399.1.92137 XP_005249638.1.92137 ENSP00000391490 HR6683 NYSGXRC-13006a ENSP00000391490 9606.ENSP00000391490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]