SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|5453549|ref|NP_006397.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|5453549|ref|NP_006397.1|
Domain Number 1 Region: 80-270
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.19e-66
Family Glutathione peroxidase-like 0.000000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|5453549|ref|NP_006397.1|
Sequence length 271
Comment peroxiredoxin-4 [Homo sapiens]
Sequence
MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVY
PGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDF
TFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDL
THQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDK
HGEVCPAGWKPGSETIIPDPAGKLKYFDKLN
Download sequence
Identical sequences A0A2I3TQU4 Q13162 V9HW63
9606.ENSP00000368646 ENSP00000368646 gi|5453549|ref|NP_006397.1| ENSP00000368646 ENSP00000368646 NP_006397.1.87134 NP_006397.1.92137 XP_008971220.1.60992 XP_016799433.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]