SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|5453708|ref|NP_006374.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|5453708|ref|NP_006374.1|
Domain Number 1 Region: 1-185
Classification Level Classification E-value
Superfamily EF-hand 1.15e-29
Family Calmodulin-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|5453708|ref|NP_006374.1|
Sequence length 187
Comment calcium and integrin-binding family member 2 [Homo sapiens]
Sequence
MGNKQTIFTEEQLDNYQDCTFFNKKDILKLHSRFYELAPNLVPMDYRKSPIVHVPMSLII
QMPELRENPFKERIVAAFSEDGEGNLTFNDFVDMFSVLCESAPRELKANYAFKIYDFNTD
NFICKEDLELTLARLTKSELDEEEVVLVCDKVIEEADLDGDGKLGFADFEDMIAKAPDFL
STFHIRI
Download sequence
Identical sequences A0A0D9RQJ0 A0A1D5QJW5 A0A2I3HXJ9 A0A2J8SK83 A0A2K5HGT6 A0A2K5LDZ0 A0A2K5U6Q0 A0A2K6C1N6 A0A2K6MJ77 A0A2K6QL87 G3R5U3 H2Q9V9 O75838
ENSPTRP00000012541 ENSNLEP00000010255 ENSP00000258930 ENSP00000258930 ENSMMUP00000012968 ENSPTRP00000012541 gi|5453708|ref|NP_006374.1| NP_001244811.1.72884 NP_006374.1.87134 NP_006374.1.92137 XP_003275496.1.23891 XP_003813850.1.60992 XP_004056645.1.27298 XP_005560250.1.63531 XP_008013923.1.81039 XP_010376961.1.97406 XP_011758919.1.29376 XP_011793821.1.43180 XP_011885455.1.92194 XP_017720833.1.44346 XP_510523.1.37143 ENSP00000258930 ENSMMUP00000012968 CIRMMP40 9544.ENSMMUP00000012968 9598.ENSPTRP00000012541 9606.ENSP00000258930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]