SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|5453766|ref|NP_006150.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|5453766|ref|NP_006150.1|
Domain Number 1 Region: 30-228
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.24e-42
Family Laminin G-like module 0.0029
Further Details:      
 
Domain Number 2 Region: 478-589
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000463
Family Growth factor receptor domain 0.0077
Further Details:      
 
Domain Number 3 Region: 432-474
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000883
Family EGF-type module 0.016
Further Details:      
 
Domain Number 4 Region: 268-332
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000105
Family VWC domain 0.016
Further Details:      
 
Domain Number 5 Region: 688-760
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000586
Family VWC domain 0.01
Further Details:      
 
Domain Number 6 Region: 595-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000241
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  gi|5453766|ref|NP_006150.1|
Domain Number - Region: 324-398
Classification Level Classification E-value
Superfamily FnI-like domain 0.000178
Family VWC domain 0.091
Further Details:      
 
Domain Number - Region: 398-432
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00322
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|5453766|ref|NP_006150.1|
Sequence length 816
Comment protein kinase C-binding protein NELL2 isoform b precursor [Homo sapiens]
Sequence
MESRVLLRTFCLIFGLGAVWGLGVDPSLQIDVLTELELGESTTGVRQVPGLHNGTKAFLF
QDTPRSIKASTATAEQFFQKLRNKHEFTILVTLKQTHLNSGVILSIHHLDHRYLELESSG
HRNEVRLHYRSGSHRPHTEVFPYILADDKWHKLSLAISASHLILHIDCNKIYERVVEKPS
TDLPLGTTFWLGQRNNAHGYFKGIMQDVQLLVMPQGFIAQCPDLNRTCPTCNDFHGLVQK
IMELQDILAKTSAKLSRAEQRMNRLDQCYCERTCTMKGTTYREFESWIDGCKNCTCLNGT
IQCETLICPNPDCPLKSALAYVDGKCCKECKSICQFQGRTYFEGERNTVYSSSGVCVLYE
CKDQTMKLVESSGCPALDCPESHQITLSHSCCKVCKGYDFCSERHNCMENSICRNLNDRA
VCSCRDGFRALREDNAYCEDIDECAEGRHYCRENTMCVNTPGSFMCICKTGYIRIDDYSC
TEHDECITNQHNCDENALCFNTVGGHNCVCKPGYTGNGTTCKAFCKDGCRNGGACIAANV
CACPQGFTGPSCETDIDECSDGFVQCDSRANCINLPGWYHCECRDGYHDNGMFSPSGESC
EDIDECGTGRHSCANDTICFNLDGGYDCRCPHGKNCTGDCIHDGKVKHNGQIWVLENDRC
SVCSCQNGFVMCRRMVCDCENPTVDLFCCPECDPRLSSQCLHQNGETLYNSGDTWVQNCQ
QCRCLQGEVDCWPLPCPDVECEFSILPENECCPRCVTDPCQADTIRNDITKTCLDEMNVV
RFTGSSWIKHGTECTLCQCKNGHICCSVDPQCLQEL
Download sequence
Identical sequences A0A024R0X1 Q99435
ENSP00000390680 ENSP00000394612 gi|223029472|ref|NP_001138580.1| gi|5453766|ref|NP_006150.1| NYSGRC-5453766 ENSP00000390680 ENSP00000394612 NP_001138580.1.87134 NP_001138580.1.92137 NP_006150.1.87134 NP_006150.1.92137 XP_005268962.1.92137 XP_011536698.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]