SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|5453898|ref|NP_006212.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|5453898|ref|NP_006212.1|
Domain Number 1 Region: 52-159
Classification Level Classification E-value
Superfamily FKBP-like 1.7e-43
Family FKBP immunophilin/proline isomerase 0.0000937
Further Details:      
 
Domain Number 2 Region: 7-37
Classification Level Classification E-value
Superfamily WW domain 0.00000000000000496
Family WW domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|5453898|ref|NP_006212.1|
Sequence length 163
Comment peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 [Homo sapiens]
Sequence
MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHL
LVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG
DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Download sequence
Identical sequences A0A0A0MWZ5 A0A2K5CB38 A0A2K5NZD5 A0A2K5S4N8 A0A2K5ZIQ9 A0A2K6CFL7 G3SBW6 H2NXH5 H2QFA4 I2CYP4 Q13526 U3DP80
NP_006212.1.87134 NP_006212.1.92137 XP_001161990.1.37143 XP_002828684.1.23681 XP_011734143.1.29376 XP_011849652.1.47321 XP_011849661.1.47321 XP_011949129.1.92194 XP_012291756.1.9421 XP_017355503.1.71028 XP_017823273.1.60252 XP_018871907.1.27298 ENSPANP00000010748 ENSPPYP00000010696 ENSPTRP00000017779 ENSP00000247970 1pinA 1nmv_A 1pin_A 9598.ENSPTRP00000017779 9600.ENSPPYP00000010696 9606.ENSP00000247970 ENSP00000247970 ENSP00000466962 ENSPTRP00000017779 gi|5453898|ref|NP_006212.1| ENSP00000247970 ENSP00000466962 ENSPPYP00000010696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]