SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|5454034|ref|NP_006263.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|5454034|ref|NP_006263.1|
Domain Number 1 Region: 1-89
Classification Level Classification E-value
Superfamily EF-hand 2.72e-24
Family S100 proteins 0.0000647
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|5454034|ref|NP_006263.1|
Sequence length 92
Comment protein S100-B [Homo sapiens]
Sequence
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMET
LDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Download sequence
Identical sequences A0A0S2Z4C5 A0A2I2UW07 A0A2K5PGS0 A0A2K6TQR8 F6RF49 G1L2S1 G1QSV6 G3S1E6 H2P3I2 H2QL65 L8YFQ5 P04271 Q6YNR6
ENSNLEP00000004024 9600.ENSPPYP00000012876 9606.ENSP00000291700 9796.ENSECAP00000010116 ENSPTRP00000024154 ENSECAP00000010116 2h61A ENSNLEP00000004024 ENSP00000291700 ENSP00000380769 ENSAMEP00000001181 ENSAMEP00000001181 ENSPPYP00000012876 ENSECAP00000010116 2h61_A 2h61_B 2h61_C 2h61_D 2h61_E 2h61_F 2h61_G 2h61_H 3czt_X 3d0y_A 3d0y_B 3d10_A 3d10_B 3hcm_A 3hcm_B 4xyn_A 4xyn_B 4xyn_C 4xyn_D 5d7f_A 5d7f_B gi|5454034|ref|NP_006263.1| NP_001076199.1.1745 NP_006263.1.87134 NP_006263.1.92137 XP_001160607.1.37143 XP_002830867.1.23681 XP_002919121.1.58354 XP_003277452.1.23891 XP_003277454.1.23891 XP_004063002.1.27298 XP_004429739.1.5094 XP_006163200.1.99106 XP_006189196.1.101512 XP_007075771.1.5354 XP_007123835.1.24612 XP_007172686.1.59432 XP_008708379.1.72690 XP_008708380.1.72690 XP_008975720.1.60992 XP_009440455.1.37143 XP_009440459.1.37143 XP_010348359.1.74449 XP_010964780.1.22495 XP_010980247.1.51371 XP_011284026.1.62641 XP_012357257.1.23891 XP_014943802.1.86478 XP_016883913.1.92137 XP_017393976.1.71028 XP_017393977.1.71028 XP_019290225.1.44245 XP_019290226.1.44245 ENSP00000291700 ENSP00000380769 ENSGGOP00000021892 000360729|e3d10A1|108.1.1.146|A:1-92 cath|current|2h61A00/0-90 cath|current|2h61B00/0-91 cath|current|2h61E00/0-90 cath|current|2h61F00/0-90 cath|current|2h61H00/0-89 cath|current|3cztX00/0-90 cath|current|3d0yB00/0-89 cath|current|3d10A00/0-91 cath|current|3d10B00/0-90 cath|current|3hcmA00/0-89 cath|current|3hcmB00/0-90 cath|current|4n6iA00/0-89 cath|current|4n6iC00/0-90 cath|current|4n6iD00/0-90 cath|current|4n6iE00/0-87 d2h61b_ d3d10a_ ENSPPYP00000012876 ENSPTRP00000024154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]