SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|5454088|ref|NP_006392.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|5454088|ref|NP_006392.1|
Domain Number 1 Region: 4-153
Classification Level Classification E-value
Superfamily L domain-like 3.33e-29
Family U2A'-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|5454088|ref|NP_006392.1|
Sequence length 251
Comment acidic leucine-rich nuclear phosphoprotein 32 family member B [Homo sapiens]
Sequence
MDMKRRIHLELRNRTPAAVRELVLDNCKSNDGKIEGLTAEFVNLEFLSLINVGLISVSNL
PKLPKLKKLELSENRIFGGLDMLAEKLPNLTHLNLSGNKLKDISTLEPLKKLECLKSLDL
FNCEVTNLNDYRESVFKLLPQLTYLDGYDREDQEAPDSDAEVDGVDEEEEDEEGEDEEDE
DDEDGEEEEFDEEDDEDEDVEGDEDDDEVSEEEEEFGLDEEDEDEDEDEEEEEGGKGEKR
KRETDDEGEDD
Download sequence
Identical sequences Q92688
gi|5454088|ref|NP_006392.1| ENSP00000345848 ENSP00000414540 ENSP00000345848 NP_006392.1.87134 NP_006392.1.92137 9606.ENSP00000345848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]