SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|54792102|ref|NP_001005915.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|54792102|ref|NP_001005915.1|
Domain Number 1 Region: 28-140
Classification Level Classification E-value
Superfamily L domain-like 1.9e-27
Family L domain 0.000000759
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|54792102|ref|NP_001005915.1|
Sequence length 183
Comment receptor tyrosine-protein kinase erbB-3 isoform s precursor [Homo sapiens]
Sequence
MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVM
GNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVM
LNYNTNSSHALRQLRLTQLTGQFPMVPSGLTPQPAQDWYLLDDDPRLLTLSASSKVPVTL
AAV
Download sequence
Identical sequences A0A2I2YIM4 K7A0H0
ENSP00000415753 ENSP00000415753 NP_001005915.1.87134 NP_001005915.1.92137 XP_004053407.2.27298 gi|54792102|ref|NP_001005915.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]