SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|55741447|ref|NP_065766.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|55741447|ref|NP_065766.1|
Domain Number 1 Region: 469-533,575-673
Classification Level Classification E-value
Superfamily PH domain-like 2.13e-32
Family Pleckstrin-homology domain (PH domain) 0.0044
Further Details:      
 
Domain Number 2 Region: 679-806
Classification Level Classification E-value
Superfamily PH domain-like 5.39e-20
Family Pleckstrin-homology domain (PH domain) 0.0089
Further Details:      
 
Domain Number 3 Region: 1093-1225
Classification Level Classification E-value
Superfamily Second domain of FERM 1.23e-18
Family Second domain of FERM 0.0056
Further Details:      
 
Weak hits

Sequence:  gi|55741447|ref|NP_065766.1|
Domain Number - Region: 994-1071
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000331
Family Ubiquitin-related 0.047
Further Details:      
 
Domain Number - Region: 37-128,580-600
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000628
Family BAR domain 0.05
Further Details:      
 
Domain Number - Region: 1229-1287
Classification Level Classification E-value
Superfamily PH domain-like 0.00959
Family Third domain of FERM 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|55741447|ref|NP_065766.1|
Sequence length 1364
Comment pleckstrin homology domain-containing family H member 1 [Homo sapiens]
Sequence
MAELKVEAPASVDWQKRCLTLETQLFRFRLQASKIRELLADKMQELEQRLLEAEQRAENA
ETQVGVMEEKVKLSNLKNVDSEGSLHRKYQELLKAIKGKDELISQLEAQLEKQKQMRAEE
AKTVQEKAAKIKEWVTLKLAKLEMENQHLKSHNQRLVEQVGSLQDALEAIQIAPSRKLLV
PPYGAAEQDSVPSEPGIQPMGQDSGSQAQGLKAAVLAPSPGALQSKDSVSEAASPLEDSS
SSTVHSGETVEAKPLQPHLGRESPPHQPCMKLLTFRCSSASWGEGLVTAQRGMLPGTKTS
AREGGPGSSLTLPKVRAPGTPRDSIQLAKRHHSQPQVGHGHFGRVVNIETEAFSALHPSG
LPELESRARSREEPEKMEMEEPPPAGKNEERESPKALGAELEEVELGNKPPTPPLHQFSS
WESRIYAVATSGMRLSDMSPRSNTACCASSPPALVSPGSFSGLVYKNVTVPVYTALKGRA
TQISNMPFMDESSGSDDDCSSQASFRISVPSSESRKTSGLGSPRAIKRGVSMSSLSSEGD
YAIPPDACSLDSDYSEPEHKLQRTSSYSTDGLGLGGESLEKSGYLLKMGSQVKTWKRRWF
VLRQGQIMYYKSPSDVIRKPQGQVDLNSRCQIVRGEGSQTFQLISEKKTYYLTADSPSLL
EEWIRVLQSLLKVQATGPPALLRGGTKPTVKGWLTKVKHGHSKVVWCALVGKIFYYYRSH
EDKRPLGCLPVRDAHIEEVDRSCDSDEDYEAGGTRRLLSSHCTLVIHPTEHSPTYLLIGT
KHEKDTWLYHLTVAAGGSSAKVGTAYEQLIGKLMDGEGDPDSPLWRHPMLCYSKDGLYAS
LTTLPSEALQTEALKLFKSCQLFINVPVEAASVDYHVSLAQTALQVCLVHPELQSEIYCQ
LMKQTSCRPPQKYSLMQCWQLLALCAPLFLPQHHFLWYVKQQLQRHADPRSETGQYATYC
QRAVERTLRTGEREARPSRMEVVSILLRNPFHHSLPFSIPVHFTNGTYHVVGFDGSSTVD
EFLQRLNQEIGMRKPSHSGFALFTDDPSGRDLEHCLQGSVKICDAISKWEQAMKELHPGK
SEGGTRVVKLMYKNRLYFRSQVKGETDRERLLLASQTSREIVAGRFPINKELALEMAALM
AQVEYGDLEKPALPGPGGTSPAKAQHLLQQVLDRFHPRRYRHGAPAEQLRHLADMLTTKW
ATLQGCSPPECIRIYLTVARKWPFFGAKLFAAQPAQLSSKENALVWIAVNEDGVSILDHN
TMQVHITYPYSSVTTFGGCRDDFMLVIRSIPDKSSGKSHIEKLIFRMAAPKIAEATFIMA
SYMNHCTTTVNPPTNPPGACQLWELDGRQFFSSVSCATKGPTLL
Download sequence
Identical sequences Q9ULM0
NP_065766.1.87134 NP_065766.1.92137 ENSP00000330278 ENSP00000330278 9606.ENSP00000330278 gi|55741447|ref|NP_065766.1| ENSP00000330278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]