SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|55741571|ref|NP_065788.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|55741571|ref|NP_065788.1|
Domain Number 1 Region: 21-286
Classification Level Classification E-value
Superfamily L domain-like 1.02e-42
Family Ngr ectodomain-like 0.0066
Further Details:      
 
Domain Number 2 Region: 284-376
Classification Level Classification E-value
Superfamily Immunoglobulin 8.53e-18
Family I set domains 0.012
Further Details:      
 
Domain Number 3 Region: 419-497
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000116
Family Fibronectin type III 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|55741571|ref|NP_065788.1|
Sequence length 789
Comment leucine-rich repeat and fibronectin type-III domain-containing protein 2 precursor [Homo sapiens]
Sequence
METLLGGLLAFGMAFAVVDACPKYCVCQNLSESLGTLCPSKGLLFVPPDIDRRTVELRLG
GNFIIHISRQDFANMTGLVDLTLSRNTISHIQPFSFLDLESLRSLHLDSNRLPSLGEDTL
RGLVNLQHLIVNNNQLGGIADEAFEDFLLTLEDLDLSYNNLHGLPWDSVRRMVNLHQLSL
DHNLLDHIAEGTFADLQKLARLDLTSNRLQKLPPDPIFARSQASALTATPFAPPLSFSFG
GNPLHCNCELLWLRRLERDDDLETCGSPGGLKGRYFWHVREEEFVCEPPLITQHTHKLLV
LEGQAATLKCKAIGDPSPLIHWVAPDDRLVGNSSRTAVYDNGTLDIFITTSQDSGAFTCI
AANAAGEATAMVEVSIVQLPHLSNSTSRTAPPKSRLSDITGSSKTSRGGGGSGGGEPPKS
PPERAVLVSEVTTTSALVKWSVSKSAPRVKMYQLQYNCSDDEVLIYRMIPASNKAFVVNN
LVSGTGYDLCVLAMWDDTATTLTATNIVGCAQFFTKADYPQCQSMHSQILGGTMILVIGG
IIVATLLVFIVILMVRYKVCNHEAPSKMAAAVSNVYSQTNGAQPPPPSSAPAGAPPQGPP
KVVVRNELLDFTASLARASDSSSSSSLGSGEAAGLGRAPWRIPPSAPRPKPSLDRLMGAF
ASLDLKSQRKEELLDSRTPAGRGAGTSARGHHSDREPLLGPPAARARSLLPLPLEGKAKR
SHSFDMGDFAAAAAGGVVPGGYSPPRKVSNIWTKRSLSVNGMLLPFEESDLVGARGTFGS
SEWVMESTV
Download sequence
Identical sequences Q9ULH4
9606.ENSP00000345985 NP_065788.1.87134 NP_065788.1.92137 XP_011513063.1.92137 XP_011513064.1.92137 XP_016866599.1.92137 gi|55741571|ref|NP_065788.1| ENSP00000345985 ENSP00000345985 NYSGRC-IgSF-LRFN2_HUMAN ENSP00000345985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]