SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|55742693|ref|NP_078922.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|55742693|ref|NP_078922.1|
Domain Number 1 Region: 336-617,644-725
Classification Level Classification E-value
Superfamily ARM repeat 8.64e-39
Family HspBP1 domain 0.074
Further Details:      
 
Domain Number 2 Region: 102-299
Classification Level Classification E-value
Superfamily RNI-like 1.49e-19
Family 28-residue LRR 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|55742693|ref|NP_078922.1|
Sequence length 744
Comment protein zyg-11 homolog B [Homo sapiens]
Sequence
MPEDQAGAAMEEASPYSLLDICLNFLTTHLEKFCSARQDGTLCLQEPGVFPQEVADRLLR
TMAFHGLLNDGTVGIFRGNQMRLKRACIRKAKISAVAFRKAFCHHKLVELDATGVNADIT
ITDIISGLGSNKWIQQNLQCLVLNSLTLSLEDPYERCFSRLSGLRALSITNVLFYNEDLA
EVASLPRLESLDISNTSITDITALLACKDRLKSLTMHHLKCLKMTTTQILDVVRELKHLN
HLDISDDKQFTSDIALRLLEQKDILPNLVSLDVSGRKHVTDKAVEAFIQQRPSMQFVGLL
ATDAGYSEFLTGEGHLKVSGEANETQIAEALKRYSERAFFVREALFHLFSLTHVMEKTKP
EILKLVVTGMRNHPMNLPVQLAASACVFNLTKQDLAAGMPVRLLADVTHLLLKAMEHFPN
HQQLQKNCLLSLCSDRILQDVPFNRFEAAKLVMQWLCNHEDQNMQRMAVAIISILAAKLS
TEQTAQLGTELFIVRQLLQIVKQKTNQNSVDTTLKFTLSALWNLTDESPTTCRHFIENQG
LELFMRVLESFPTESSIQQKVLGLLNNIAEVQELHSELMWKDFIDHISSLLHSVEVEVSY
FAAGIIAHLISRGEQAWTLSRSQRNSLLDDLHSAILKWPTPECEMVAYRSFNPFFPLLGC
FTTPGVQLWAVWAMQHVCSKNPSRYCSMLIEEGGLQHLYNIKDHEHTDPHVQQIAVAILD
SLEKHIVRHGRPPPCKKQPQARLN
Download sequence
Identical sequences A0A096MLB2 A0A0D9S795 A0A2K6CWZ6 G3RQW6 G7MH10 H2N7D5 H2PZ15 Q9C0D3
ENSPTRP00000001279 ENSPANP00000000324 ENSPPYP00000001561 NP_078922.1.87134 NP_078922.1.92137 XP_001139134.2.37143 XP_007976925.1.81039 XP_009248536.1.23681 XP_011762527.1.29376 XP_018874183.1.27298 ENSP00000294353 gi|55742693|ref|NP_078922.1| ENSPTRP00000001279 ENSP00000294353 ENSPPYP00000001561 ENSP00000294353 9598.ENSPTRP00000001279 9600.ENSPPYP00000001561 9606.ENSP00000294353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]