SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|55749998|ref|NP_001007024.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|55749998|ref|NP_001007024.1|
Domain Number 1 Region: 143-240
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000473
Family Thioltransferase 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|55749998|ref|NP_001007024.1|
Sequence length 309
Comment type II iodothyronine deiodinase isoform b [Homo sapiens]
Sequence
MGILSVDLLITLQILPVFFSNCLFLALYDSVILLKHVVLLLSRSKSTRGEWRRMLTSEGL
RCVWKSFLLDAYKQLNCPPSGFSKDGHILULVYEAYKSRLLVYSHLDLWMVKLGEDAPNS
SVVHVSSTEGGDNSGNGTQEKIAEGATCHLLDFASPERPLVVNFGSATUPPFTSQLPAFR
KLVEEFSSVADFLLVYIDEAHPSDGWAIPGDSSLSFEVKKHQNQEDRCAAAQQLLERFSL
PPQCRVVADRMDNNANIAYGVAFERVCIVQRQKIAYLGGKGPFSYNLQEVRHWLEKNFSK
RUKKTRLAG
Download sequence
Identical sequences NP_001007024.1.87134 NP_001007024.1.92137 ENSP00000451265 ENSP00000450980 gi|55749998|ref|NP_001007024.1| ENSP00000450980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]