SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|55770842|ref|NP_000558.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|55770842|ref|NP_000558.2|
Domain Number 1 Region: 20-224
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.38e-43
Family Pentraxin (pentaxin) 0.00000000257
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|55770842|ref|NP_000558.2|
Sequence length 224
Comment C-reactive protein precursor [Homo sapiens]
Sequence
MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTE
LSSTRGYSIFSYATKRQDNEILIFWSKDIGYSFTVGGSEILFEVPEVTVAPVHICTSWES
ASGIVEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQDSFGGNFEGSQSLVGDIGNVNMW
DFVLSPDEINTIYLGGPFSPNVLNWRALKYEVQGEVFTKPQLWP
Download sequence
Identical sequences P02741
gi|55770842|ref|NP_000558.2| ENSP00000255030 NP_000558.2.87134 NP_000558.2.92137 XP_011507509.1.92137 ENSP00000255030 ENSP00000255030 9606.ENSP00000255030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]