SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|55956790|ref|NP_001007098.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|55956790|ref|NP_001007098.1|
Domain Number 1 Region: 66-166
Classification Level Classification E-value
Superfamily L domain-like 2.53e-16
Family Ngr ectodomain-like 0.00042
Further Details:      
 
Domain Number 2 Region: 203-290
Classification Level Classification E-value
Superfamily Immunoglobulin 8.34e-16
Family I set domains 0.039
Further Details:      
 
Domain Number 3 Region: 283-383
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000123
Family I set domains 0.00000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|55956790|ref|NP_001007098.1|
Sequence length 477
Comment BDNF/NT-3 growth factors receptor isoform b precursor [Homo sapiens]
Sequence
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEP
NSVDPENITEIFIANQKRLEIINEDDVEAYVGLRNLTIVDSGLKFVAHKAFLKNSNLQHI
NFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMYWDVGNLVSKHM
NETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHH
WCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIPST
DVTDKTGREHLSVYAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGFVLFHKIPLDG
Download sequence
Identical sequences K7CUJ9 Q5VWE5
gi|55956790|ref|NP_001007098.1| ENSP00000352906 ENSP00000379221 ENSP00000352906 ENSP00000379221 NP_001007098.1.87134 NP_001007098.1.92137 XP_005252064.1.92137 XP_008959621.1.60992 XP_009242831.1.23681 XP_016816541.1.37143 XP_016816542.1.37143 XP_016870247.1.92137 XP_016870248.1.92137 XP_016870249.1.92137 XP_016870250.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]