SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|55956794|ref|NP_001007157.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|55956794|ref|NP_001007157.1|
Domain Number 1 Region: 78-190
Classification Level Classification E-value
Superfamily L domain-like 1.19e-19
Family Ngr ectodomain-like 0.00039
Further Details:      
 
Domain Number 2 Region: 210-307
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000103
Family I set domains 0.012
Further Details:      
 
Domain Number 3 Region: 321-392
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000578
Family I set domains 0.000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|55956794|ref|NP_001007157.1|
Sequence length 612
Comment NT-3 growth factor receptor isoform c precursor [Homo sapiens]
Sequence
MDVSLCPAKCSFWRIFLLGSVWLDYVGSVLACPANCVCSKTEINCRRPDDGNLFPLLEGQ
DSGNSNGNASINITDISRNITSIHIENWRSLHTLNAVDMELYTGLQKLTIKNSGLRSIQP
RAFAKNPHLRYINLSSNRLTTLSWQLFQTLSLRELQLEQNFFNCSCDIRWMQLWQEQGEA
KLNSQNLYCINADGSQLPLFRMNISQCDLPEISVSHVNLTVREGDNAVITCNGSGSPLPD
VDWIVTGLQSINTHQTNLNWTNVHAINLTLVNVTSEDNGFTLTCIAENVVGMSNASVALT
VYYPPRVVSLEEPELRLEHCIEFVVRGNPPPTLHWLHNGQPLRESKIIHVEYYQEGEISE
GCLLFNKPTHYNNGNYTLIAKNPLGTANQTINGHFLKEPFPESTDNFILFDEVSPTPPIT
VTHKPEEDTFGVSIAVGLAAFACVLLVVLFVMINKYGRRSKFGMKGPVAVISGEEDSASP
LHHINHGITTPSSLDAGPDTVVIGMTRIPVIENPQYFRQGHNCHKPDTWVFSNIDNHGIL
NLKDNRDHLVPSTHYIYEEPEVQSGEVSYPRSHGFREIMLNPISLPGHSKPLNHGIYVED
VNVYFSKGRHGF
Download sequence
Identical sequences Q96CY4
ENSP00000318328 ENSP00000444673 ENSP00000318328 ENSP00000444673 gi|55956794|ref|NP_001007157.1| NP_001007157.1.87134 NP_001007157.1.92137 XP_011519939.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]