SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56118210|ref|NP_001007793.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56118210|ref|NP_001007793.1|
Domain Number 1 Region: 458-743
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.55e-81
Family Protein kinases, catalytic subunit 0.000000156
Further Details:      
 
Domain Number 2 Region: 48-153
Classification Level Classification E-value
Superfamily L domain-like 1.3e-20
Family Ngr ectodomain-like 0.00000254
Further Details:      
 
Domain Number 3 Region: 259-350
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000119
Family I set domains 0.00000372
Further Details:      
 
Domain Number 4 Region: 164-259
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000133
Family I set domains 0.00000779
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56118210|ref|NP_001007793.1|
Sequence length 760
Comment high affinity nerve growth factor receptor isoform 3 [Homo sapiens]
Sequence
MKEAALICLAPSVPPILTVKSWDTMQLRAARSRCTNLLAASYIENQQHLQHLELRDLRGL
GELRNLTIVKSGLRFVAPDAFHFTPRLSRLNLSFNALESLSWKTVQGLSLQELVLSGNPL
HCSCALRWLQRWEEEGLGGVPEQKLQCHGQGPLAHMPNASCGVPTLKVQVPNASVDVGDD
VLLRCQVEGRGLEQAGWILTELEQSATVMKSGGLPSLGLTLANVTSDLNRKNVTCWAEND
VGRAEVSVQVNVSFPASVQLHTAVEMHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFT
EFLEPAANETVRHGCLRLNQPTHVNNGNYTLLAANPFGQASASIMAAFMDNPFEFNPEDP
IPDTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVL
APEDGLAMSLHFMTLGGSSLSPTEGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWEL
GEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTMLQHQHIVRFF
GVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAA
GMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPP
ESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEV
YAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLG
Download sequence
Identical sequences ENSP00000376120 ENSP00000376120 gi|56118210|ref|NP_001007793.1| NP_001007793.1.87134 NP_001007793.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]