SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56549117|ref|NP_001005336.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56549117|ref|NP_001005336.1|
Domain Number 1 Region: 3-303
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.84e-90
Family G proteins 0.0000000000584
Further Details:      
 
Domain Number 2 Region: 520-627
Classification Level Classification E-value
Superfamily PH domain-like 1.01e-24
Family Pleckstrin-homology domain (PH domain) 0.00000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56549117|ref|NP_001005336.1|
Sequence length 851
Comment dynamin-1 isoform 2 [Homo sapiens]
Sequence
MGNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRG
SGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPI
NLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSD
LANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQK
DIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKL
QSQLLSIEKEVEEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGA
RINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDMAFETIVKKQVKKI
REPCLKCVDMVISELISTVRQCTKKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLID
IELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQDEILVIRKGWLTINNIGIMKGGSKE
YWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDY
RQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENGSDSFMHSMDPQLERQVE
TIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAE
QAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQVQSVPAGRRSPTSSPT
PQRRAPAVPPARPGSRGPAPGPPPAGSALGGAPPVPSRPGASPDPFGPPPQVPSRPNRAP
PGVPRITISDP
Download sequence
Identical sequences A0A2J8UK41 A0A2K5USW3 A0A2K6C5H4 H2R2B8
ENSP00000345680 NP_001005336.1.87134 NP_001005336.1.92137 XP_003312333.1.37143 XP_005251826.1.92137 XP_005580827.1.63531 XP_011709820.1.29376 XP_011709821.1.29376 XP_011894391.1.92194 XP_011894392.1.92194 XP_014972226.1.72884 XP_014972228.1.72884 XP_015291900.1.63531 XP_015291902.1.63531 XP_015291903.1.63531 XP_016817262.1.37143 XP_016869860.1.92137 ENSP00000345680 ENSPTRP00000058895 gi|56549117|ref|NP_001005336.1| ENSPTRP00000043717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]