SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56549694|ref|NP_001008493.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56549694|ref|NP_001008493.1|
Domain Number 1 Region: 1-147
Classification Level Classification E-value
Superfamily PH domain-like 2.35e-44
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000144
Further Details:      
 
Domain Number 2 Region: 551-589
Classification Level Classification E-value
Superfamily Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.00000000000301
Family Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.0017
Further Details:      
 
Weak hits

Sequence:  gi|56549694|ref|NP_001008493.1|
Domain Number - Region: 361-371
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00157
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|56549694|ref|NP_001008493.1|
Sequence length 591
Comment protein enabled homolog isoform a [Homo sapiens]
Sequence
MSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVI
NCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFASAMMHALEVLNSQETGPTL
PRQNSQLPAQVQNGPSQEELEIQRRQLQEQQRQKELERERLERERMERERLERERLERER
LERERLEQEQLERERQERERQERLERQERLERQERLERQERLDRERQERQERERLERLER
ERQERERQEQLEREQLEWERERRISSAAAPASVETPLNSVLGDSSASEPGLQAASQPAET
PSQQGIVLGPLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQV
PPPPPPPPAPPLPASGFFLASMSEDNRPLTGLAAAIAGAKLRKVSRMEDTSFPSGGNAIG
VNSASSKTDTGRGNGPLPLGGSGLMEEMSALLARRRRIAEKGSTIETEQKEDKGEDSEPV
TSKASSTSTPEPTRKPWERTNTMNGSKSPVISRRDSPRKNQIVFDNRSYDSLHRPKSTPL
SQPSANGVQTEGLDYDRLKQDILDEMRKELTKLKEELIDAIRQELSKSNTA
Download sequence
Identical sequences Q8N8S7
gi|56549694|ref|NP_001008493.1| ENSP00000355809 NP_001008493.1.87134 NP_001008493.1.92137 ENSP00000355809 9606.ENSP00000355809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]