SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56682953|ref|NP_004438.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56682953|ref|NP_004438.3|
Domain Number 1 Region: 61-187
Classification Level Classification E-value
Superfamily PH domain-like 5.6e-52
Family Phosphotyrosine-binding domain (PTB) 0.0000706
Further Details:      
 
Domain Number 2 Region: 532-606
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000289
Family SH3-domain 0.00005
Further Details:      
 
Weak hits

Sequence:  gi|56682953|ref|NP_004438.3|
Domain Number - Region: 726-781
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000153
Family Pointed domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56682953|ref|NP_004438.3|
Sequence length 822
Comment epidermal growth factor receptor kinase substrate 8 [Homo sapiens]
Sequence
MNGHISNHPSSFGMYPSQMNGYGSSPTFSQTDREHGSKTSAKALYEQRKNYARDSVSSVS
DISQYRVEHLTTFVLDRKDAMITVDDGIRKLKLLDAKGKVWTQDMILQVDDRAVSLIDLE
SKNELENFPLNTIQHCQAVMHSCSYDSVLALVCKEPTQNKPDLHLFQCDEVKANLISEDI
ESAISDSKGGKQKRRPDALRMISNADPSIPPPPRAPAPAPPGTVTQVDVRSRVAAWSAWA
ADQGDFEKPRQYHEQEETPEMMAARIDRDVQILNHILDDIEFFITKLQKAAEAFSELSKR
KKNKKGKRKGPGEGVLTLRAKPPPPDEFLDCFQKFKHGFNLLAKLKSHIQNPSAADLVHF
LFTPLNMVVQATGGPELASSVLSPLLNKDTIDFLNYTVNGDERQLWMSLGGTWMKARAEW
PKEQFIPPYVPRFRNGWEPPMLNFMGATMEQDLYQLAESVANVAEHQRKQEIKRLSTEHS
SVSEYHPADGYAFSSNIYTRGSHLDQGEAAVAFKPTSNRHIDRNYEPLKTQPKKYAKSKY
DFVARNNSELSVLKDDILEILDDRKQWWKVRNASGDSGFVPNNILDIVRPPESGLGRADP
PYTHTIQKQRMEYGPRPADTPPAPSPPPTPAPVPVPLPPSTPAPVPVSKVPANITRQNSS
SSDSGGSIVRDSQRHKQLPVDRRKSQMEEVQDELIHRLTIGRSAAQKKFHVPRQNVPVIN
ITYDSTPEDVKTWLQSKGFNPVTVNSLGVLNGAQLFSLNKDELRTVCPEGARVYSQITVQ
KAALEDSSGSSELQEIMRRRQEKISAAASDSGVESFDEGSSH
Download sequence
Identical sequences Q12929
ENSP00000281172 ENSP00000441867 ENSP00000442388 ENSP00000281172 ENSP00000441867 ENSP00000442388 HR3568 hso002000428.2 hso002000428.3 gi|56682953|ref|NP_004438.3| NP_004438.3.87134 NP_004438.3.92137 9606.ENSP00000281172 ENSP00000281172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]