SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56699403|ref|NP_001006642.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56699403|ref|NP_001006642.1|
Domain Number 1 Region: 220-494
Classification Level Classification E-value
Superfamily Mitochondrial carrier 1.23e-79
Family Mitochondrial carrier 0.0000671
Further Details:      
 
Domain Number 2 Region: 44-212
Classification Level Classification E-value
Superfamily EF-hand 4.61e-39
Family Calmodulin-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|56699403|ref|NP_001006642.1|
Sequence length 503
Comment calcium-binding mitochondrial carrier protein SCaMC-2 isoform b [Homo sapiens]
Sequence
MVSSVLCRCVASPPPDAAATAASSSASSPASVGDPCGGAICGGPDHRLRLWRLFQTLDVN
RDGGLCVNDLAVGLRRLGLHRTEGELQKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLRLV
FKSLDKKNDGRIDAQEIMQSLRDLGVKISEQQAEKILKSMDKNGTMTIDWNEWRDYHLLH
PVENIPEIILYWKHSTIFDVGENLTVPDEFTVEERQTGMWWRHLVAGGGAGAVSRTCTAP
LDRLKVLMQVHASRSNNMGIVGGFTQMIREGGARSLWRGNGINVLKIAPESAIKFMAYEQ
IKRLVGSDQETLRIHERLVAGSLAGAIAQSSIYPMEVLKTRMALRKTGQYSGMLDCARRI
LAREGVAAFYKGYVPNMLGIIPYAGIDLAVYETLKNAWLQHYAVNSADPGVFVLLACGTM
SSTCGQLASYPLALVRTRMQAQASIEGAPEVTMSSLFKHILRTEGAFGLYRGLAPNFMKV
IPAVSISYVVYENLKITLGVQSR
Download sequence
Identical sequences NP_001006642.1.87134 NP_001006642.1.92137 ENSP00000362159 gi|56699403|ref|NP_001006642.1| ENSP00000362159 9606.ENSP00000362159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]