SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|56788381|ref|NP_996532.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56788381|ref|NP_996532.2|
Domain Number 1 Region: 33-147
Classification Level Classification E-value
Superfamily Immunoglobulin 1.47e-21
Family V set domains (antibody variable domain-like) 0.0000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|56788381|ref|NP_996532.2|
Sequence length 247
Comment myelin-oligodendrocyte glycoprotein isoform alpha1 precursor [Homo sapiens]
Sequence
MASLSRPSLPSCLCSFLLLLLLQVSSSYAGQFRVIGPRHPIRALVGDEVELPCRISPGKN
ATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFS
DEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGVLVLLAVLPVLLLQITVGLIFLCLQY
RLRGKLRAEIENLHRTFDPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLAGQFL
EELRNPF
Download sequence
Identical sequences Q16653
NP_996532.2.87134 NP_996532.2.92137 ENSP00000366115 gi|56788381|ref|NP_996532.2| ENSP00000366115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]