SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|5729937|ref|NP_006545.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|5729937|ref|NP_006545.1|
Domain Number 1 Region: 106-131,175-252
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.0000000000709
Family Glutathione S-transferase (GST), C-terminal domain 0.02
Further Details:      
 
Weak hits

Sequence:  gi|5729937|ref|NP_006545.1|
Domain Number - Region: 42-119
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00157
Family Glutathione S-transferase (GST), N-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|5729937|ref|NP_006545.1|
Sequence length 263
Comment metaxin-2 [Homo sapiens]
Sequence
MSLVAEAFVSQIAAAEPWPENATLYQQLKGEQILLSDNAASLAVQAFLQMCNLPIKVVCR
ANAEYMSPSGKVPFIHVGNQVVSELGPIVQFVKAKGHSLSDGLEEVQKAEMKAYMELVNN
MLLTAELYLQWCDEATVGEITHARYGSPYPWPLNHILAYQKQWEVKRKMKAIGWGKKTLD
QVLEDVDQCCQALSQRLGTQPYFFNKQPTELDALVFGHLYTILTTQLTNDELSEKVKNYS
NLLAFCRRIEQHYFEDRGKGRLS
Download sequence
Identical sequences H2QJ15 O75431
ENSP00000376314 9598.ENSPTRP00000021654 9606.ENSP00000249442 NP_006545.1.87134 NP_006545.1.92137 XP_003815584.1.60992 XP_515932.2.37143 ENSP00000249442 HR4953 ENSPTRP00000021654 ENSP00000249442 gi|5729937|ref|NP_006545.1| ENSPTRP00000021654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]