SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|5730059|ref|NP_006644.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|5730059|ref|NP_006644.1|
Domain Number 1 Region: 9-132
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-38
Family Phosphotyrosine-binding domain (PTB) 0.00000317
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|5730059|ref|NP_006644.1|
Sequence length 492
Comment fibroblast growth factor receptor substrate 3 [Homo sapiens]
Sequence
MGSCCSCLNRDSVPDNHPTKFKVTNVDDEGVELGSGVMELTQSELVLHLHRREAVRWPYL
CLRRYGYDSNLFSFESGRRCQTGQGIFAFKCSRAEEIFNLLQDLMQCNSINVMEEPVIIT
RNSHPAELDLPRAPQPPNALGYTVSSFSNGCPGEGPRFSAPRRLSTSSLRHPSLGEESTH
ALIAPDEQSHTYVNTPASEDDHRRGRHCLQPLPEGQAPFLPQARGPDQRDPQVFLQPGQV
KFVLGPTPARRHMVKCQGLCPSLHDPPHHNNNNEAPSECPAQPKCTYENVTGGLWRGAGW
RLSPEEPGWNGLAHRRAALLHYENLPPLPPVWESQAQQLGGEAGDDGDSRDGLTPSSNGF
PDGEEDETPLQKPTSTRAAIRSHGSFPVPLTRRRGSPRVFNFDFRRPGPEPPRQLNYIQV
ELKGWGGDRPKGPQNPSSPQAPMPTTHPARSSDSYAVIDLKKTVAMSNLQRALPRDDGTA
RKTRHNSTDLPL
Download sequence
Identical sequences A0A140VJJ7 O43559
ENSP00000259748 ENSP00000362109 gi|5730059|ref|NP_006644.1| NP_006644.1.87134 NP_006644.1.92137 XP_011512556.1.92137 XP_011512557.1.92137 ENSP00000259748 ENSP00000259748 ENSP00000362109 9606.ENSP00000259748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]