SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|5802974|ref|NP_006784.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|5802974|ref|NP_006784.1|
Domain Number 1 Region: 64-255
Classification Level Classification E-value
Superfamily Thioredoxin-like 1e-69
Family Glutathione peroxidase-like 0.0000000898
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|5802974|ref|NP_006784.1|
Sequence length 256
Comment thioredoxin-dependent peroxide reductase, mitochondrial isoform a precursor [Homo sapiens]
Sequence
MAAAVGRLLRASVARHVSAIPWGISATAALRPAACGRTSLTNLLCSGSSQAKLFSTSSSC
HAPAVTQHAPYFKGTAVVNGEFKDLSLDDFKGKYLVLFFYPLDFTFVCPTEIVAFSDKAN
EFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIALLSDLTKQISRDYGVLLEGSG
LALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQYVETHGEVCPANWTPDSPTI
KPSPAASKEYFQKVNQ
Download sequence
Identical sequences G3SIJ5 H2Q2N6 P30048
ENSP00000298510 ENSGGOP00000027935 ENSP00000298510 NP_006784.1.87134 NP_006784.1.92137 XP_003825694.1.60992 XP_003951819.1.37143 XP_004050226.1.27298 HR6790 ENSGGOP00000018774 gi|5802974|ref|NP_006784.1| ENSP00000298510 ENSPTRP00000005275 ENSPTRP00000005275 9598.ENSPTRP00000005275 9606.ENSP00000298510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]