SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|5803013|ref|NP_006808.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|5803013|ref|NP_006808.1|
Domain Number 1 Region: 155-261
Classification Level Classification E-value
Superfamily ERP29 C domain-like 5.49e-30
Family ERP29 C domain-like 0.00000324
Further Details:      
 
Domain Number 2 Region: 36-151
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.32e-24
Family ERP29 N domain-like 0.00000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|5803013|ref|NP_006808.1|
Sequence length 261
Comment endoplasmic reticulum resident protein 29 isoform 1 precursor [Homo sapiens]
Sequence
MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVIPKSKFVLVKF
DTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYL
FRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQAL
LKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEE
LQKSLNILTAFQKKGAEKEEL
Download sequence
Identical sequences P30040 V9HW71
ENSP00000261735 ENSP00000261735 9606.ENSP00000261735 gi|5803013|ref|NP_006808.1| ENSP00000261735 NP_006808.1.87134 NP_006808.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]