SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|5803121|ref|NP_006801.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|5803121|ref|NP_006801.1|
Domain Number 1 Region: 268-382
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.12e-33
Family PDI-like 0.0059
Further Details:      
 
Domain Number 2 Region: 398-502
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.84e-30
Family PDI-like 0.0047
Further Details:      
 
Domain Number 3 Region: 114-258
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.2e-26
Family PDI-like 0.0087
Further Details:      
 
Domain Number 4 Region: 35-142
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000341
Family ERP29 N domain-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|5803121|ref|NP_006801.1|
Sequence length 519
Comment protein disulfide-isomerase A5 precursor [Homo sapiens]
Sequence
MARAGPAWLLLAIWVVLPSWLSSAKVSSLIERISDPKDLKKLLRTRNNVLVLYSKSEVAA
ENHLRLLSTVAQAVKGQGTICWVDCGDAESRKLCKKMKVDLSPKDKKVELFHYQDGAFHT
EYNRAVTFKSIVAFLKDPKGPPLWEEDPGAKDVVHLDSEKDFRRLLKKEEKPLLIMFYAP
WCSMCKRMMPHFQKAATQLRGHAVLAGMNVYSSEFENIKEEYSVRGFPTICYFEKGRFLF
QYDNYGSTAEDIVEWLKNPQPPQPQVPETPWADEGGSVYHLTDEDFDQFVKEHSSVLVMF
HAPWCGHCKKMKPEFEKAAEALHGEADSSGVLAAVDATVNKALAERFHISEFPTLKYFKN
GEKYAVPVLRTKKKFLEWMQNPEAPPPPEPTWEEQQTSVLHLVGDNFRETLKKKKHTLVM
FYAPWCPHCKKVIPHFTATADAFKDDRKIACAAVDCVKDKNQDLCQQEAVKGYPTFHYYH
YGKFAEKYDSDRTELGFTNYIRALREGDHERLGKKKEEL
Download sequence
Identical sequences Q14554
gi|5803121|ref|NP_006801.1| NP_006801.1.87134 NP_006801.1.92137 ENSP00000417199 ENSP00000323313 ENSP00000323313 9606.ENSP00000323313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]