SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|5803163|ref|NP_006813.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|5803163|ref|NP_006813.1|
Domain Number 1 Region: 11-181
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.57e-44
Family G proteins 0.000017
Further Details:      
 
Domain Number 2 Region: 189-227
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000102
Family SOCS box-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|5803163|ref|NP_006813.1|
Sequence length 278
Comment ras-related protein Rab-40B [Homo sapiens]
Sequence
MSALGSPVRAYDFLLKFLLVGDSDVGKGEILASLQDGAAESPYGHPAGIDYKTTTILLDG
RRVKLQLWDTSGQGRFCTIFRSYSRGAQGVILVYDIANRWSFDGIDRWIKEIDEHAPGVP
KILVGNRLHLAFKRQVPTEQAQAYAERLGVTFFEVSPLCNFNITESFTELARIVLLRHGM
DRLWRPSKVLSLQDLCCRAVVSCTPVHLVDKLPLPIALRSHLKSFSMANGLNARMMHGGS
YSLTTSSTHKRSSLRKVKLVRPPQSPPKNCTRNSCKIS
Download sequence
Identical sequences K7CVZ9 Q12829
ENSP00000269347 NP_006813.1.87134 NP_006813.1.92137 XP_511769.3.37143 9606.ENSP00000269347 ENSP00000461785 gi|5803163|ref|NP_006813.1| ENSP00000461785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]