SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|5803177|ref|NP_006741.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|5803177|ref|NP_006741.1|
Domain Number 1 Region: 189-300
Classification Level Classification E-value
Superfamily PH domain-like 2.01e-37
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 2 Region: 86-195
Classification Level Classification E-value
Superfamily PDZ domain-like 5.26e-25
Family PDZ domain 0.00033
Further Details:      
 
Weak hits

Sequence:  gi|5803177|ref|NP_006741.1|
Domain Number - Region: 337-436
Classification Level Classification E-value
Superfamily PH domain-like 0.00566
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|5803177|ref|NP_006741.1|
Sequence length 540
Comment beta-2-syntrophin [Homo sapiens]
Sequence
MRVAAATAAAGAGPAMAVWTRATKAGLVELLLRERWVRVVAELSGESLSLTGDAAAAELE
PALGPAAAAFNGLPNGGGAGDSLPGSPSRGLGPPSPPAPPRGPAGEAGASPPVRRVRVVK
QEAGGLGISIKGGRENRMPILISKIFPGLAADQSRALRLGDAILSVNGTDLRQATHDQAV
QALKRAGKEVLLEVKFIREVTPYIKKPSLVSDLPWEGAAPQSPSFSGSEDSGSPKHQNST
KDRKIIPLKMCFAARNLSMPDLENRLIELHSPDSRNTLILRCKDTATAHSWFVAIHTNIM
ALLPQVLAELNAMLGATSTAGGSKEVKHIAWLAEQAKLDGGRQQWRPVLMAVTEKDLLLY
DCMPWTRDAWASPCHSYPLVATRLVHSGSGCRSPSLGSDLTFATRTGSRQGIEMHLFRVE
THRDLSSWTRILVQGCHAAAELIKEVSLGCMLNGQEVRLTIHYENGFTISRENGGSSSIL
YRYPFERLKMSADDGIRNLYLDFGGPEGELTMDLHSCPKPIVFVLHTFLSAKVTRMGLLV
Download sequence
Identical sequences A0A024R732 G1R088 Q13425
NP_006741.1.87134 NP_006741.1.92137 ENSP00000338191 ENSP00000458573 ENSP00000338191 ENSNLEP00000006609 gi|5803177|ref|NP_006741.1| ENSNLEP00000006609 ENSP00000338191 ENSP00000458999 HR3084 9606.ENSP00000338191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]