SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|58331175|ref|NP_065762.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|58331175|ref|NP_065762.1|
Domain Number 1 Region: 255-281
Classification Level Classification E-value
Superfamily Moesin tail domain 0.0000196
Family Moesin tail domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|58331175|ref|NP_065762.1|
Sequence length 284
Comment ermin isoform b [Homo sapiens]
Sequence
MTDVPATFTQAECNGDKPPENGQQTITKISEELTDVDSPLPHYRVEPSLEGALTKGSQEE
RRKLQGNMLLNSSMEDKMLKENPEEKLFIVHKAITDLSLQETSADEMTFREGHQWEKIPL
SGSNQEIRRQKERITEQPLKEEEDEDRKNKGHQAAEIEWLGFRKPSQADMLHSKHDEEQK
VWDEEIDDDDDDNCNNDEDEVRVIEFKKKHEEVSQFKEEGDASEDSPLSSASSQAVTPDE
QPTLGKKSDISRNAYSRYNTISYRKIRKGNTKQRIDEFESMMHL
Download sequence
Identical sequences Q8TAM6
NP_001291273.1.87134 NP_001291273.1.92137 NP_001291274.1.87134 NP_001291274.1.92137 NP_065762.1.87134 NP_065762.1.92137 ENSP00000387047 ENSP00000387047 gi|58331175|ref|NP_065762.1| GO.35401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]