SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|58761546|ref|NP_055828.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|58761546|ref|NP_055828.2|
Domain Number 1 Region: 276-670,751-756,787-829
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.21e-98
Family FAD-linked reductases, N-terminal domain 0.000000000000599
Further Details:      
 
Domain Number 2 Region: 183-266
Classification Level Classification E-value
Superfamily Homeodomain-like 4.56e-35
Family SWIRM domain 0.00000327
Further Details:      
 
Domain Number 3 Region: 655-763
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.76e-30
Family L-aminoacid/polyamine oxidase 0.00000057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|58761546|ref|NP_055828.2|
Sequence length 852
Comment lysine-specific histone demethylase 1A isoform b [Homo sapiens]
Sequence
MLSGKKAAAAAAAAAAAATGTEAGPGTAGGSENGSEVAAQPAGLSGPAEVGPGAVGERTP
RKKEPPRASPPGGLAEPPGSAGPQAGPTVVPGSATPMETGIAETPEGRRTSRRKRAKVEY
REMDESLANLSEDEYYSEEERNAKAEKEKKLPPPPPQAPPEEENESEPEEPSGVEGAAFQ
SRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLEA
PYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPTKKTGKVIIIGSGVSGLAAARQLQSF
GMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGGNPMAVVSKQVNMELAKIKQKC
PLYEANGQAVPKEKDEMVEQEFNRLLEATSYLSHQLDFNVLNNKPVSLGQALEVVIQLQE
KHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKIKELHQQYKEASEVKPPRDITAEFLV
KSKHRDLTALCKEYDELAETQGKLEEKLQELEANPPSDVYLSSRDRQILDWHFANLEFAN
ATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVPVALAEGLDIKLNTAVRQVRYTASGC
EVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPPAVQFVPPLPEWKTSAVQRMGFGNLN
KVVLCFDRVFWDPSVNLFGHVGSTTASRGELFLFWNLYKAPILLALVAGEAAGIMENISD
DVIVGRCLAILKGIFGSSAVPQPKETVVSRWRADPWARGSYSYVAAGSSGNDYDLMAQPI
TPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRIADQFLGAMYTLPRQA
TPGVPAQQSPSM
Download sequence
Identical sequences O60341
gi|58761546|ref|NP_055828.2| HR3647 ENSP00000349049 2xaf_A 2xag_A 2xah_A 2xaj_A 2xaq_A 2xas_A 4uxn_A 5lhg_A 5lhh_A 5lhi_A NP_055828.2.87134 NP_055828.2.92137 ENSP00000349049 9606.ENSP00000349049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]