SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|5901898|ref|NP_008923.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|5901898|ref|NP_008923.1|
Domain Number 1 Region: 73-255
Classification Level Classification E-value
Superfamily L domain-like 7.94e-26
Family Internalin LRR domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|5901898|ref|NP_008923.1|
Sequence length 312
Comment leucine-rich repeat-containing protein 23 isoform b [Homo sapiens]
Sequence
MSDEDDLEDSEPDQDDSEKEEDEKETEEGEDYRKEGEEFPEEWLPTPLTEDMMKEGLSLL
CKTGNGLAHAYVKLEVKERDLTDIYLLRSYIHLRYVDISENHLTDLSPLNYLTHLLWLKA
DGNRLRSAQMNELPYLQIASFAYNQITDTEGISHPRLETLNLKGNSIHMVTGLDPEKLIS
LHTVELRGNQLESTLGINLPKLKNLYLAQNMLKKVEGLEDLSNLTTLHLRDNQIDTLSGF
SREMKSLQYLNLRRSKTLAFRPDQTPRGSHHMYDREQRMPVFAPKLEIHHNLRPRICSVP
VLWAVWGAEWGA
Download sequence
Identical sequences ENSP00000317464 gi|5901898|ref|NP_008923.1| NP_008923.1.87134 NP_008923.1.92137 ENSP00000317464 ENSP00000469058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]