SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|5901956|ref|NP_009016.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|5901956|ref|NP_009016.1|
Domain Number 1 Region: 34-98
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000013
Family Ovomucoid domain III-like 0.0058
Further Details:      
 
Domain Number 2 Region: 141-222
Classification Level Classification E-value
Superfamily EF-hand 0.000000000032
Family S100 proteins 0.085
Further Details:      
 
Domain Number 3 Region: 228-269
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000262
Family VWC domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|5901956|ref|NP_009016.1|
Sequence length 308
Comment follistatin-related protein 1 precursor [Homo sapiens]
Sequence
MWKRWLALALALVAVAWVRAEEELRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQCKP
HKRPVCGSNGKTYLNHCELHRDACLTGSKIQVDYDGHCKEKKSVSPSASPVVCYQSNRDE
LRRRIIQWLEAEIIPDGWFSKGSNYSEILDKYFKNFDNGDSRLDSSEFLKFVEQNETAIN
ITTYPDQENNKLLRGLCVDALIELSDENADWKLSFQEFLKCLNPSFNPPEKKCALEDETY
ADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTEEEMTRYVQELQKHQETAEKT
KRVSTKEI
Download sequence
Identical sequences A0A096MTK1 A0A1D5Q5V4 A0A2K5NT37 A0A2K5U4N2 Q12841
ENSMMUP00000003914 ENSP00000295633 ENSPANP00000003135 ENSMMUP00000003914 9544.ENSMMUP00000003914 9606.ENSP00000295633 ENSP00000295633 NP_001231516.1.72884 NP_009016.1.87134 NP_009016.1.92137 XP_005548104.1.63531 XP_011923845.1.92194 gi|5901956|ref|NP_009016.1| ENSP00000295633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]