SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|5901992|ref|NP_008966.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|5901992|ref|NP_008966.1|
Domain Number 1 Region: 26-346
Classification Level Classification E-value
Superfamily L domain-like 6.8e-46
Family Ngr ectodomain-like 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|5901992|ref|NP_008966.1|
Sequence length 352
Comment keratocan precursor [Homo sapiens]
Sequence
MAGTICFIMWVLFITDTVWSRSVRQVYEVHDSDDWTIHDFECPMECFCPPSFPTALYCEN
RGLKEIPAIPSRIWYLYLQNNLIETIPEKPFENATQLRWINLNKNKITNYGIEKGALSQL
KKLLFLFLEDNELEEVPSPLPRSLEQLQLARNKVSRIPQGTFSNLENLTLLDLQNNKLVD
NAFQRDTFKGLKNLMQLNMAKNALRNMPPRLPANTMQLFLDNNSIEGIPENYFNVIPKVA
FLRLNHNKLSDEGLPSRGFDVSSILDLQLSHNQLTKVPRISAHLQHLHLDHNKIKSVNVS
VICPSPSMLPAERDSFSYGPHLRYLRLDGNEIKPPIPMALMTCFRLLQAVII
Download sequence
Identical sequences O60938
9606.ENSP00000266719 NP_008966.1.87134 NP_008966.1.92137 gi|5901992|ref|NP_008966.1| ENSP00000266719 ENSP00000266719 ENSP00000266719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]