SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|5902018|ref|NP_008961.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|5902018|ref|NP_008961.1|
Domain Number 1 Region: 46-179
Classification Level Classification E-value
Superfamily EF-hand 1.96e-46
Family p25-alpha 0.0000092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|5902018|ref|NP_008961.1|
Sequence length 219
Comment tubulin polymerization-promoting protein [Homo sapiens]
Sequence
MADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSALEEAFRRFAV
HGDARATGREMHGKNWSKLCKDCQVIDGRNVTVTDVDIVFSKIKGKSCRTITFEQFQEAL
EELAKKRFKDKSSEEAVREVHRLIEGKAPIISGVTKAISSPTVSRLTDTTKFTGSHKERF
DPSGKGKGKAGRVDLVDESGYVSGYKHAGTYDQKVQGGK
Download sequence
Identical sequences O94811 Q4L233
NP_008961.1.87134 NP_008961.1.92137 XP_005248294.2.92137 XP_016864483.1.92137 ENSP00000353785 ENSP00000353785 gi|5902018|ref|NP_008961.1| ENSP00000353785 9606.ENSP00000353785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]