SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59676593|ref|NP_001012277.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59676593|ref|NP_001012277.1|
Domain Number 1 Region: 90-131,198-409
Classification Level Classification E-value
Superfamily RNI-like 2.55e-19
Family 28-residue LRR 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|59676593|ref|NP_001012277.1|
Sequence length 474
Comment PRAME family member 7 [Homo sapiens]
Sequence
MSIRAPPRLLELARQRLLRDQALAISTMEELPRELFPTLFMEAFSRRRCETLKTMVQAWP
FTRLPLGSLMKSPHLESLKSVLEGVDVLLTQEVRPRQSKLQVLDLRNVDENFCDIFSGAT
ASFPEALSQKQTADNCPGTGRQQPFMVFIDLCLKNRTLDECLTHLLEWGKQRKGLLHVCC
KELQVFGMPIHSIIEVLNMVELDCIQEVEVCCPWELSTLVKFAPYLGQMRNLRKLVLFNI
RASACIPPDNKGQFIARFTSQFLKLDYFQNLSMHSVSFLEGHLDQLLRCLQASLEMVVMT
DCLLSESDLKHLSWCPSIRQLKELDLRGVTLTHFSPEPLTGLLEQVVATLQTLDLEDCGI
MDSQLSAILPVLSRCSQLSTFSFCGNLISMAALENLLRHTVGLSKLSLELYPAPLESYDT
QGALCWGRFAELGAELMKTPRDLRQPKIIVFCTVPCPRCGIRASYDLEPSHCLC
Download sequence
Identical sequences ENSP00000328915 ENSP00000354371 9606.ENSP00000328915 gi|59676593|ref|NP_001012277.1| ENSP00000328915 HR6106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]