SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59889562|ref|NP_001012338.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59889562|ref|NP_001012338.1|
Domain Number 1 Region: 514-824
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.32e-82
Family Protein kinases, catalytic subunit 0.000000255
Further Details:      
 
Domain Number 2 Region: 78-190
Classification Level Classification E-value
Superfamily L domain-like 1.98e-19
Family Ngr ectodomain-like 0.00039
Further Details:      
 
Domain Number 3 Region: 210-307
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000162
Family I set domains 0.012
Further Details:      
 
Domain Number 4 Region: 321-392
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000914
Family I set domains 0.000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|59889562|ref|NP_001012338.1|
Sequence length 839
Comment NT-3 growth factor receptor isoform a precursor [Homo sapiens]
Sequence
MDVSLCPAKCSFWRIFLLGSVWLDYVGSVLACPANCVCSKTEINCRRPDDGNLFPLLEGQ
DSGNSNGNASINITDISRNITSIHIENWRSLHTLNAVDMELYTGLQKLTIKNSGLRSIQP
RAFAKNPHLRYINLSSNRLTTLSWQLFQTLSLRELQLEQNFFNCSCDIRWMQLWQEQGEA
KLNSQNLYCINADGSQLPLFRMNISQCDLPEISVSHVNLTVREGDNAVITCNGSGSPLPD
VDWIVTGLQSINTHQTNLNWTNVHAINLTLVNVTSEDNGFTLTCIAENVVGMSNASVALT
VYYPPRVVSLEEPELRLEHCIEFVVRGNPPPTLHWLHNGQPLRESKIIHVEYYQEGEISE
GCLLFNKPTHYNNGNYTLIAKNPLGTANQTINGHFLKEPFPESTDNFILFDEVSPTPPIT
VTHKPEEDTFGVSIAVGLAAFACVLLVVLFVMINKYGRRSKFGMKGPVAVISGEEDSASP
LHHINHGITTPSSLDAGPDTVVIGMTRIPVIENPQYFRQGHNCHKPDTYVQHIKRRDIVL
KRELGEGAFGKVFLAECYNLSPTKDKMLVAVKALKDPTLAARKDFQREAELLTNLQHEHI
VKFYGVCGDGDPLIMVFEYMKHGDLNKFLRAHGPDAMILVDGQPRQAKGELGLSQMLHIA
SQIASGMVYLASQHFVHRDLATRNCLVGANLLVKIGDFGMSRDVYSTDYYRLFNPSGNDF
CIWCEVGGHTMLPIRWMPPESIMYRKFTTESDVWSFGVILWEIFTYGKQPWFQLSNTEVI
ECITQGRVLERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG
Download sequence
Identical sequences Q16288 X5D2R1
ENSP00000354207 NYSGRC-IgSF-NTRK3_HUMAN gi|59889562|ref|NP_001012338.1| ENSP00000354207 9606.ENSP00000354207 NP_001012338.1.87134 NP_001012338.1.92137 XP_016877742.1.92137 ENSP00000350356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]