SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|6031162|ref|NP_009019.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|6031162|ref|NP_009019.1|
Domain Number 1 Region: 6-178
Classification Level Classification E-value
Superfamily EF-hand 8.18e-28
Family Calmodulin-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|6031162|ref|NP_009019.1|
Sequence length 192
Comment calretinin isoform 22k [Homo sapiens]
Sequence
MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEKARKGSGMMSK
SDNFGEKMKEFMQKYDKNSDGKIEMAELAQILPTEENFLLCFRQHVGSSAEFMEAWRKYD
TDRSGYIEANELKGFLSDLLKKANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSRIE
AATLTSMSWMPF
Download sequence
Identical sequences A6NER6
ENSP00000340294 NP_009019.1.87134 NP_009019.1.92137 gi|6031162|ref|NP_009019.1| ENSP00000340294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]