SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|61102721|ref|NP_001010890.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|61102721|ref|NP_001010890.1|
Domain Number 1 Region: 165-410
Classification Level Classification E-value
Superfamily RNI-like 9.03e-21
Family 28-residue LRR 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|61102721|ref|NP_001010890.1|
Sequence length 478
Comment PRAME family member 9/15 [Homo sapiens]
Sequence
MKMSIRTPPRLLELAGRSLLRDQALAMSTLEELPTELFPPLFMEAFSRRRCEALKLMVQA
WPFRRLPLRPLIKMPCLEAFQAVLDGLDALLTQGVRPRRWKLQVLDLQDVCENFWMVWSE
AMAHGCFLNAKRNKKPVQDCPRMRGRQPLTVFVELWLKNRTLDEYLTYLLLWVKQRKDLL
HLCCKKLKILGMPFRNIRSILKMVNLDCIQEVEVNCKWVLPILTQFTPYLGHMRNLQKLV
LSHMDVSRYVSPEQKKEIVTQFTTQFLKLRCLQKLYMNSVSFLEGHLDQLLSCLKTSLKV
LTITNCVLLESDLKHLSQCPSISQLKTLDLSGIRLTNYSLVPLQILLEKVAATLEYLDLD
DCGIIDSQVNAILPALSRCFELNTFSFCGNPICMATLENLLSHTIILKNLCVELYPAPRE
SYGADGTLCWSRFAQIRAELMNRVRDLRHPKRILFCTDYCPDCGNRSFYDLEADQYCC
Download sequence
Identical sequences Q5VWM5
NP_001091846.1.87134 NP_001091846.1.92137 ENSP00000365322 ENSP00000327917 ENSP00000365322 gi|148356236|ref|NP_001091846.1| gi|61102721|ref|NP_001010890.1| ENSP00000330156 ENSP00000365322 9606.ENSP00000327917 9606.ENSP00000365322 HR6151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]