SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|61742817|ref|NP_001013424.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|61742817|ref|NP_001013424.1|
Domain Number 1 Region: 470-582
Classification Level Classification E-value
Superfamily Second domain of FERM 5.1e-16
Family Second domain of FERM 0.0032
Further Details:      
 
Domain Number 2 Region: 284-365
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000482
Family Ankyrin repeat 0.0029
Further Details:      
 
Weak hits

Sequence:  gi|61742817|ref|NP_001013424.1|
Domain Number - Region: 374-464
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.061
Family Ras-binding domain, RBD 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|61742817|ref|NP_001013424.1|
Sequence length 688
Comment krev interaction trapped protein 1 isoform 2 [Homo sapiens]
Sequence
MGNPENIEDAYVAVIRPKNTASLNSREYRAKSYEILLHEVPIEGQKKKRKKVLLETKLQG
NSEITQGILDYVVETTKPISPANQGIRGKRVVLMKKFPLDGEKMGREASLFIVPSVVKDN
TKYTYTPGCPIFYCLQDIMRVCSESSTHFATLTARMLIALDKWLDERHAQSHFIPALFRP
SPLERIKTNVINPAYATESGQTENSLHMGYSALEIKSKMLALEKADTCIYNPLFGSDLQY
TNRVDKVVINPYFGLGAPDYSKIQIPKQEKWQRSMSSVTEDKYGKVEATRILLEKGKCNP
NLLNGQLSSPLHFAAGGGHAEIVQILLNHPETDRHITDQQGRSPLNICEENKQNNWEEAA
KLLKEAINKPYEKVRIYRMDGSYRSVELKHGNNTTVQQIMEGMRLSQETQQYFTIWICSE
NLSLQLKPYHKPLQHVRDWPEILAELTNLDPQRETPQLFLRRDVRLPLEVEKQIEDPLAI
LILFDEARYNLLKGFYTAPDAKLITLASLLLQIVYGNYESKKHKQGFLNEENLKSIVPVT
KLKSKAPHWTNRILHEYKNLSTSEGVSKEMHHLQRMFLQNCWEIPTYGAAFFTGQIFTKA
SPSNHKVIPVYVGVNIKGLHLLNMETKALLISLKYGCFMWQLGDTDTCFQIHSMENKMSF
IVHTKQAGLVVKLLMKLNGQLMPTERNS
Download sequence
Identical sequences NP_001013424.1.87134 NP_001013424.1.92137 ENSP00000378011 gi|61742817|ref|NP_001013424.1| ENSP00000378011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]