SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|61806622|ref|NP_001013460.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|61806622|ref|NP_001013460.1|
Domain Number 1 Region: 47-91
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000115
Family EGF-type module 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|61806622|ref|NP_001013460.1|
Sequence length 133
Comment epigen [Homo sapiens]
Sequence
MALGVPISVYLLFNAMTALTEEAAVTVTPPITAQQADNIEGPIALKFSHLCLEDHNSYCI
NGACAFHHELEKAICRCFTGYTGERCEHLTLTSYAVDSYEKYIAIGIGVGLLLSGFLVIF
YCYIRKRYEKDKI
Download sequence
Identical sequences A0A2J8PFH6 H2PDL5
gi|61806622|ref|NP_001013460.1| ENSP00000330375 ENSPPYP00000016566 9598.ENSPTRP00000027782 9600.ENSPPYP00000016566 9606.ENSP00000330375 ENSPPYP00000016566 ENSP00000330375 XP_005265723.1.92137 XP_008955971.1.60992 XP_009238356.1.23681 XP_018880679.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]