SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|62243769|ref|NP_001013863.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62243769|ref|NP_001013863.1|
Domain Number 1 Region: 17-146
Classification Level Classification E-value
Superfamily PH domain-like 2.33e-22
Family Pleckstrin-homology domain (PH domain) 0.0002
Further Details:      
 
Domain Number 2 Region: 147-238
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000000771
Family SH2 domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|62243769|ref|NP_001013863.1|
Sequence length 403
Comment signal-transducing adaptor protein 2 isoform 2 [Homo sapiens]
Sequence
MASALRPPRVPKPKGVLPSHYYESFLEKKGPCDRDYKKFWAGLQGLTIYFYNSNRDFQHV
EKLNLGAFEKLTDEIPWGSSRDPGTHFSLILRDQEIKFKVETLECREMWKGFILTVVELR
VPTDLTLLPGHLYMMSEVLAKEEARRALETPSCFLKVSRLEAQLLLERYPECGNLLLRPS
GDGADGVSVTTRQMHNGTHVVRHYKVKREGPKYVIDVEQPFSCTSLDAVVNYFVSHTKKA
LVPFLLDEDYEKVLGYVEADKENGENVWVAPSAPGPGPAPCTGGPKPLSPASSQDKLPPL
PPLPNQEENYVTPIGDGPAVDYENQDVASSSWPVILKPKKLPKPPAKLPKPPVGPKPEPK
VFNGGLGRKLPVSSAQPLFPTAGLADMTAELQKKLEKRRALEH
Download sequence
Identical sequences Q9UGK3
ENSP00000471052 gi|62243769|ref|NP_001013863.1| ENSP00000471052 NP_001013863.1.87134 NP_001013863.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]