SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|62548860|ref|NP_002371.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62548860|ref|NP_002371.3|
Domain Number 1 Region: 611-836
Classification Level Classification E-value
Superfamily vWA-like 7.05e-63
Family Integrin A (or I) domain 0.00028
Further Details:      
 
Domain Number 2 Region: 46-238
Classification Level Classification E-value
Superfamily vWA-like 1.06e-56
Family Integrin A (or I) domain 0.00023
Further Details:      
 
Domain Number 3 Region: 240-361
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.88e-18
Family Growth factor receptor domain 0.0072
Further Details:      
 
Domain Number 4 Region: 323-443
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.77e-18
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 5 Region: 405-565
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000133
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 6 Region: 570-614
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000144
Family EGF-type module 0.012
Further Details:      
 
Domain Number 7 Region: 912-953
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.0000000353
Family Chicken cartilage matrix protein 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|62548860|ref|NP_002371.3|
Sequence length 956
Comment matrilin-2 isoform a precursor [Homo sapiens]
Sequence
MEKMLAGCFLLILGQIVLLPAEARERSRGRSISRGRHARTHPQTALLESSCENKRADLVF
IIDSSRSVNTHDYAKVKEFIVDILQFLDIGPDVTRVGLLQYGSTVKNEFSLKTFKRKSEV
ERAVKRMRHLSTGTMTGLAIQYALNIAFSEAEGARPLRENVPRVIMIVTDGRPQDSVAEV
AAKARDTGILIFAIGVGQVDFNTLKSIGSEPHEDHVFLVANFSQIETLTSVFQKKLCTAH
MCSTLEHNCAHFCINIPGSYVCRCKQGYILNSDQTTCRIQDLCAMEDHNCEQLCVNVPGS
FVCQCYSGYALAEDGKRCVAVDYCASENHGCEHECVNADGSYLCQCHEGFALNPDKKTCT
KIDYCASSNHGCQHECVNTDDSYSCHCLKGFTLNPDKKTCRRINYCALNKPGCEHECVNM
EESYYCRCHRGYTLDPNGKTCSRVDHCAQQDHGCEQLCLNTEDSFVCQCSEGFLINEDLK
TCSRVDYCLLSDHGCEYSCVNMDRSFACQCPEGHVLRSDGKTCAKLDSCALGDHGCEHSC
VSSEDSFVCQCFEGYILREDGKTCRRKDVCQAIDHGCEHICVNSDDSYTCECLEGFRLAE
DGKRCRRKDVCKSTHHGCEHICVNNGNSYICKCSEGFVLAEDGRRCKKCTEGPIDLVFVI
DGSKSLGEENFEVVKQFVTGIIDSLTISPKAARVGLLQYSTQVHTEFTLRNFNSAKDMKK
AVAHMKYMGKGSMTGLALKHMFERSFTQGEGARPLSTRVPRAAIVFTDGRAQDDVSEWAS
KAKANGITMYAVGVGKAIEEELQEIASEPTNKHLFYAEDFSTMDEISEKLKKGICEALED
SDGRQDSPAGELPKTVQQPTESEPVTINIQDLLSCSNFAVQHRYLFEEDNLLRSTQKLSH
STKPSGSPLEEKHDQCKCENLIMFQNLANEEVRKLTQRLEEMTQRMEALENRLRYR
Download sequence
Identical sequences A0A140VKH7 O00339
gi|62548860|ref|NP_002371.3| NP_002371.3.87134 NP_002371.3.92137 ENSP00000254898 ENSP00000430487 ENSP00000430487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]