SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|62739179|ref|NP_001015055.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62739179|ref|NP_001015055.1|
Domain Number 1 Region: 312-437
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000448
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Weak hits

Sequence:  gi|62739179|ref|NP_001015055.1|
Domain Number - Region: 39-91
Classification Level Classification E-value
Superfamily HR1 repeat 0.00288
Family HR1 repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|62739179|ref|NP_001015055.1|
Sequence length 563
Comment rhotekin isoform a [Homo sapiens]
Sequence
MFSRNHRSRVTVARGSALEMEFKRGRFRLSLFSDLPEDTELQRKLDHEIRMREGACKLLA
ACSQREQALEATKSLLVCNSRILSYMGELQRRKEAQVLGKTSRRPSDSGPPAERSPCRGR
VCISDLRIPLMWKDTEYFKNKGDLHRWAVFLLLQLGEHIQDTEMILVDRTLTDISFQSNV
LFAEAGPDFELRLELYGACVEEEGALTGGPKRLATKLSSSLGRSSGRRVRASLDSAGGSG
SSPILLPTPVVGGPRYHLLAHTTLTLAAVQDGFRTHDLTLASHEENPAWLPLYGSVCCRL
AAQPLCMTQPTASGTLRVQQAGEMQNWAQVHGVLKGTNLFCYRQPEDADTGEEPLLTIAV
NKETRVRAGELDQALGRPFTLSISNQYGDDEVTHTLQTESREALQSWMEALWQLFFDMSQ
WKQCCDEIMKIETPAPRKPPQALAKQGSLYHEMAIEPLDDIAAVTDILTQREGARLETPP
PWLAMFTDQPALPNPCSPASVAPAPDWTHPLPWGRPRTFSLDAVPPDHSPRARSVAPLPP
QRSPRTRGLCSKGQPRTWLQSPV
Download sequence
Identical sequences Q9BST9
ENSP00000272430 ENSP00000272430 gi|62739179|ref|NP_001015055.1| 9606.ENSP00000272430 ENSP00000272430 NP_001015055.1.87134 NP_001015055.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]