SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|62865654|ref|NP_060260.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62865654|ref|NP_060260.3|
Domain Number 1 Region: 26-149
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.64e-22
Family Synaptotagmin-like (S variant) 0.00098
Further Details:      
 
Domain Number 2 Region: 182-262
Classification Level Classification E-value
Superfamily PDZ domain-like 1.73e-17
Family PDZ domain 0.0000153
Further Details:      
 
Domain Number 3 Region: 440-543
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000211
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|62865654|ref|NP_060260.3|
Sequence length 602
Comment regulator of G-protein signaling 3 isoform 3 [Homo sapiens]
Sequence
MERSLHRVSLGSRRAHPDLSFYLTTFGQLRLSIDAQDRVLLLHIIEGKGLISKQPGTCDP
YVKISLIPEDSRLRHQKTQTVPDCRDPAFHEHFFFPVQEEDDQKRLLVTVWNRASQSRQS
GLIGCMSFGVKSLLTPDKEISGWYYLLGEHLGRTKHLKVARRRLRPLRDPLLRMPGGGDT
ENGKKLKITIPRGKDGFGFTICCDSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPVEHW
KCVELAHEIRSCPSEIILLVWRMVPQVKPGPDGGVLRRASCKSTHDLQSPPNKREKNCTH
GVQARPEQRHSCHLVCDSSDGLLLGGWERYTEVAKRGGQHTLPALSRATAPTDPNYIILA
PLNPGSQLLRPVYQEDTIPEESGSPSKGKSYTGLGKKSRLMKTVQTMKGHGNYQNCPVVR
PHATHSSYGTYVTLAPKVLVFPVFVQPLDLCNPARTLLLSEELLLYEGRNKAAEVTLFAY
SDLLLFTKEDEPGRCDVLRNPLYLQSVKLQEGSSEDLKFCVLYLAEKAECLFTLEAHSQE
QKKRVCWCLSENIAKQQQLAASPPDSKKLHPFGSLQQEMGPVNSTNATQDRSFTSPGQTL
IG
Download sequence
Identical sequences ENSP00000312844 gi|62865654|ref|NP_060260.3| NP_060260.3.87134 NP_060260.3.92137 ENSP00000312844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]