SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|62899065|ref|NP_060610.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62899065|ref|NP_060610.2|
Domain Number 1 Region: 26-142
Classification Level Classification E-value
Superfamily L domain-like 6.12e-21
Family U2A'-like 0.033
Further Details:      
 
Weak hits

Sequence:  gi|62899065|ref|NP_060610.2|
Domain Number - Region: 496-580
Classification Level Classification E-value
Superfamily PspA lactotransferrin-binding region 0.00131
Family PspA lactotransferrin-binding region 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|62899065|ref|NP_060610.2|
Sequence length 647
Comment centrosomal protein of 72 kDa [Homo sapiens]
Sequence
MARAGPRLVLSEEAVRAKSGLGPHRDLAELQSLSIPGTYQEKITHLGHSLMSLTGLKSLD
LSRNSLVSLEGIQYLTALESLNLYYNCISSLAEVFRLHALTELVDVDFRLNPVVKVEPDY
RLFVVHLLPKLQQLDDRPVRASERKASRLHFASEDSLDSKESVPASLKEGRPHHPRAKCT
EALAKQSLVMDADDEAVLNLIAECEWDLGRPPGSTSFSQKGREADSRGSQESRHLLSPQL
VQYQCGDSGKQGRETRRSSCRGCCLEKMPWSQLCGELPPLYGAEPEASRAPRPHTYFTPH
PDSMDTEDSASSQKLDLSGEMVPGPLPAPGKCRKRRMPVGRFQTFSDQEGLGCPERTHGS
SVPKESLSRQDSSESRNGRTLSQPEASETEEQRSRGVTDTREPSPGSHSALPGKKTALQA
ALLETLLDLVDRSWGGCRSLHSNEAFLAQARHILSSVEEFTAAQDSSAMVGEDVGSLALE
SKSLQSRLAEQQQQHAREMSEVTAELHHTHKELDDLRQHLDKSLEENSRLKSLLLSMKKE
VKSADTAATLNLQIAGLQTSVKRLCGEIVELKQHLEHYDKIQELTQMLQESHSSLVSTNE
HLLQELSQVRAQHRAEVEQMHWSYQELKKTMALFPHSSASHGGCQAC
Download sequence
Identical sequences Q9P209
NP_060610.2.87134 NP_060610.2.92137 XP_011512365.1.92137 gi|62899065|ref|NP_060610.2| ENSP00000264935 ENSP00000264935 ENSP00000264935 9606.ENSP00000264935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]